Protein Info for GFF2853 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: probable two-component sensor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 584 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 51 to 67 (17 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details PF00512: HisKA" amino acids 212 to 280 (69 residues), 36.7 bits, see alignment E=5.3e-13 PF02518: HATPase_c" amino acids 326 to 437 (112 residues), 88.5 bits, see alignment E=6.1e-29 PF00072: Response_reg" amino acids 476 to 581 (106 residues), 36.3 bits, see alignment E=8.7e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (584 amino acids)

>GFF2853 probable two-component sensor (Hydrogenophaga sp. GW460-11-11-14-LB1)
MDRDALSFRAGRDEQPDPEDSAHTVASLWALRACELLCALMFATALPWQQPAAWFSVIAG
MGMLRWWHVNRPSFRALPKARRRRAYRIYMWVLMAFVGSACWFLYVPDNVPMLAVLMSYL
LGNATLIAVRLTGDVVRTTIALCLAVLPTSVRLIVDGLGGHTLLVLMGIGGILMTVTMVF
LSRAQEIGVMRQVEQRRRAEAAADTVAALGLAKSRFFAAVSHDLRQPVHAIGLYLAPLVS
LAERAQDRAALRAIDGIGQSWRALDDLLSQVLDLTRMDSGVVQAELRPTELAPLVASLVR
QHSAVAEAAGVRIVALVRPEAFALADGLMLVRVLSNLMDNAIKFSSAGATVLVALRRGEG
GCWRLQVRDAGLGIAPEAQARIFEEFVQMHNEGRDRRQGLGLGLAIARRLALLMNGDIAV
RAALGQGCCMTVTLPRAQPPPEPAPVVANELPSMPGALLLMPEHAVPSPAFAVERVLLVE
DDSLVAAATRDQLVGWGLQVLHVETAAEALAQSAFGDVAICDVRLPHAASGLDLALSLRE
RGQRVLLISGETHAALRESASRHRLPLLIKPVSSAQLLAALQGL