Protein Info for GFF2850 in Xanthobacter sp. DMC5

Annotation: L-threonate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF02826: 2-Hacid_dh_C" amino acids 2 to 107 (106 residues), 28.2 bits, see alignment E=2.3e-10 PF03446: NAD_binding_2" amino acids 3 to 161 (159 residues), 145.5 bits, see alignment E=3e-46 PF03807: F420_oxidored" amino acids 3 to 75 (73 residues), 26.9 bits, see alignment E=1.3e-09 PF14833: NAD_binding_11" amino acids 165 to 284 (120 residues), 109.6 bits, see alignment E=2.4e-35

Best Hits

Swiss-Prot: 30% identical to GARR_ECOLI: 2-hydroxy-3-oxopropionate reductase (garR) from Escherichia coli (strain K12)

KEGG orthology group: K00020, 3-hydroxyisobutyrate dehydrogenase [EC: 1.1.1.31] (inferred from 70% identity to xau:Xaut_1538)

MetaCyc: 30% identical to tartronate semialdehyde reductase (Escherichia coli K-12 substr. MG1655)
2-hydroxy-3-oxopropionate reductase. [EC: 1.1.1.60]

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.30, 1.1.1.31, 1.1.1.60

Use Curated BLAST to search for 1.1.1.30 or 1.1.1.31 or 1.1.1.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (292 amino acids)

>GFF2850 L-threonate dehydrogenase (Xanthobacter sp. DMC5)
MKKIGFVGLGSMGLPMAGNLARAGFDVTGFDLRPEAGTKLAAAGGVAATSLTDAFAGQDA
AVLMVVNATQAEDILFGAGALAHLPEGGTVILMATCPPAAVAALAKRVEAEGRRLVDAPV
SGGVVGAEAGSLTIMVAAPSDLFAQVKPVLDAMGSKVVLLGEKAGQGATAKAVNQLLCGV
HLAVAGEALSLAETLGLDMNAMLDIVSGSAASSWMLRDRGPRMLESEPRVTSAVDIFVKD
LGIVLEAGAGAKTALPLAATAHQMFLAVSGQGKGAKDDSKVIDAYRALQGRA