Protein Info for GFF2847 in Methylophilus sp. DMC18

Annotation: Ribosome-binding factor A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 TIGR00082: ribosome-binding factor A" amino acids 1 to 109 (109 residues), 110.8 bits, see alignment E=2.7e-36 PF02033: RBFA" amino acids 7 to 107 (101 residues), 117.6 bits, see alignment E=1.5e-38

Best Hits

Swiss-Prot: 68% identical to RBFA_METFK: Ribosome-binding factor A (rbfA) from Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875)

KEGG orthology group: K02834, ribosome-binding factor A (inferred from 71% identity to meh:M301_0121)

Predicted SEED Role

"Ribosome-binding factor A" in subsystem NusA-TFII Cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (118 amino acids)

>GFF2847 Ribosome-binding factor A (Methylophilus sp. DMC18)
MAKAFSRNDRISEQMRRELADLLMFEIKDPRVQMVTLTGVEVAGDMAHAKVFYTAQKNSK
GLQAGLEKAAGFLRTQLGKRMMIRTVPQLHFVYDESIDRGMHMDKLISDALSDTPPQE