Protein Info for GFF2841 in Xanthobacter sp. DMC5

Annotation: Vitamin B12 import ATP-binding protein BtuD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 748 PF00501: AMP-binding" amino acids 30 to 356 (327 residues), 89.6 bits, see alignment E=3e-29 PF00005: ABC_tran" amino acids 508 to 669 (162 residues), 109.9 bits, see alignment E=2.4e-35 PF12399: BCA_ABC_TP_C" amino acids 718 to 742 (25 residues), 45.1 bits, see alignment (E = 8.6e-16)

Best Hits

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (748 amino acids)

>GFF2841 Vitamin B12 import ATP-binding protein BtuD (Xanthobacter sp. DMC5)
MNRAFDHASGAAERADPCPADTLPGALIAAARRHAARPALRHKVGGIWRTWTFADYLART
AAMTRLLDGAGFTGEGLLVTVGENRPELYAAALAAQGLGAAVMPVGPEFLRRFGAPAADP
ALVLCENEEAARAWRTASRSPAIVLRLDECAPSPEAAQDEAVAWYAWRAARVEGSRTALI
LHTAGVDGPPRPVALTHRRLLDAGAVAMSRLQLSPTDRLMAFLPVSGIADAAGSLVQPLL
AGCSLHCVEGPASFPNDLREVAPTVLAAPARVFELLVRDAGVRLSAGGPLVRALARASEK
GLPGTGLAFGAPLRNTLGVGACRLAFVTSGILDPTTAGRLAAYGVPLDGDIALADDGSLR
SRSGAAADDPHLLRSVEAVLRGEAVIDRARVTRIPGGLSARIALAPSAADAEDTATAQSH
ASAAVERVNARLAAEFPGTSLAIRAFDLAADGFGPQELTLEGEVRDAPFAPGGREAQARP
TERAARSRGPVLMQVSGVAVAFGGVKALSDVSLAIHEGEILSIIGPNGAGKTSLLNVING
VYHPRSGTITFAGKARARMRPAFAARSGIGRTFQHVSLFKGMNVIDNVLVGRAARFEGSL
LGKLLRLPSTSAEERREREAAERILAFLELEHLRKAPVASLPYGIQKRVELARALATEPR
LLLLDEPMAGMTHEEKRDMCGFIRRVNESFGTTILIIEHDIGVVMGLSDRVAVLNYGRKI
ADGTPDVVRADPQVIAAYLGSAALGEAA