Protein Info for GFF2840 in Variovorax sp. SCN45

Annotation: Integral membrane protein, interacts with FtsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 173 to 190 (18 residues), see Phobius details amino acids 203 to 228 (26 residues), see Phobius details PF01027: Bax1-I" amino acids 24 to 225 (202 residues), 153.4 bits, see alignment E=3.7e-49

Best Hits

Swiss-Prot: 35% identical to Y1358_VIBCH: Uncharacterized membrane protein VC_1358 (VC_1358) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K06890, (no description) (inferred from 96% identity to vpe:Varpa_2053)

Predicted SEED Role

"Putative TEGT family carrier/transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>GFF2840 Integral membrane protein, interacts with FtsH (Variovorax sp. SCN45)
MNDRVTTLDTSTGYGQPLAQAERQRVLRNTYWLLALSLLPTVLGAWVGVSTGITRSLTGG
LGLIVFLGGAFGFMFAIEKTKNSAAGVPVLLGFTFFMGLMLSRLIAMVLGFKNGSELIMT
AFGGTAGVFFVMASLATIIKRDLSGMGKFLFVGAMVLMFGAIINVFVGSSTGMLVISVAA
IGIFSAYMLYDLKQIMDGGETNYITATLALYLDLFNVFQSLLALLGIFGGERD