Protein Info for GFF284 in Xanthobacter sp. DMC5

Annotation: Sarcosine oxidase subunit delta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 94 PF04267: SoxD" amino acids 2 to 80 (79 residues), 106.1 bits, see alignment E=4.1e-35

Best Hits

Swiss-Prot: 39% identical to SOXD_CORS1: Sarcosine oxidase subunit delta (soxD) from Corynebacterium sp. (strain P-1)

KEGG orthology group: K00304, sarcosine oxidase, subunit delta [EC: 1.5.3.1] (inferred from 84% identity to xau:Xaut_4701)

MetaCyc: 39% identical to sarcosine oxidase delta subunit (Corynebacterium sp.)
RXN-22742 [EC: 1.5.3.24]

Predicted SEED Role

"Sarcosine oxidase delta subunit (EC 1.5.3.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (EC 1.5.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.5.3.1

Use Curated BLAST to search for 1.5.3.1 or 1.5.3.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (94 amino acids)

>GFF284 Sarcosine oxidase subunit delta (Xanthobacter sp. DMC5)
MRITCPYCGARSSHEFAYLGDAAPTRPDPADPEAPDAFNAYVYERDNVAGVMDELWYHAG
GCRRWLTVTRDTRTHAITAVRFTTTRFTGTEAAE