Protein Info for GFF284 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 48 to 73 (26 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 189 to 196 (8 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 63 to 236 (174 residues), 40.8 bits, see alignment E=1e-14

Best Hits

Swiss-Prot: 63% identical to YDCV_ECOLI: Inner membrane ABC transporter permease protein YdcV (ydcV) from Escherichia coli (strain K12)

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 76% identity to smd:Smed_2190)

MetaCyc: 63% identical to putative ABC transporter membrane subunit YdcV (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (249 amino acids)

>GFF284 Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VLFLHIPLALIILYAFSAEDKSYVFPPPGLTTQWFAAAWAREDVWAAIGLSFRVALIATA
LAMVLGTLAAAGLARTRFFGRDAISLLLILPIALPGIITGIALRTAYHTMEIPFSFWTIV
VGHATFCVVVVYNNAVARLRRTSPSLIEASMDLGADSFQTIRYVILPQLGSALLAGGLLA
FALSFDEVIVTTFTAGQQTTLPIWMLQELIRPRQRPVTNVVAVVIIALTFIPILAAYVLT
RADEQPNGR