Protein Info for GFF2836 in Xanthobacter sp. DMC5

Annotation: 3-oxoacyl-[acyl-carrier-protein] reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF23441: SDR" amino acids 16 to 259 (244 residues), 44.7 bits, see alignment E=2.3e-15 PF00106: adh_short" amino acids 19 to 212 (194 residues), 209.1 bits, see alignment E=9e-66 PF08659: KR" amino acids 21 to 176 (156 residues), 47.7 bits, see alignment E=3.6e-16 PF13561: adh_short_C2" amino acids 28 to 261 (234 residues), 243.4 bits, see alignment E=5.1e-76

Best Hits

Swiss-Prot: 38% identical to GNO_GLUOX: Gluconate 5-dehydrogenase (gno) from Gluconobacter oxydans (strain 621H)

KEGG orthology group: None (inferred from 57% identity to mil:ML5_2240)

MetaCyc: 38% identical to D-gluconate 5-dehydrogenase monomer (Gluconobacter oxydans 621H)
1.1.1.-

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>GFF2836 3-oxoacyl-[acyl-carrier-protein] reductase (Xanthobacter sp. DMC5)
MGLALPLPHPAPMPGLAGKIVIVTGGGRGLGRAVAEGFAHAGAHVVLSGRSAETLAEAVA
AIATQGGSAEGIAADVASETDVEALARTVVERHGRIDVLVNNAGINPWYKTAEDTSLAEW
RQVVDTNLTGVFLAARAAGRVMLAQGEGAIVNITSVAGRVGLARTTAYCAAKGGVELMTR
QLALEWAKKGVRVNAVGPGYFETELTEGMRQNPKLAERVTGRTPMGRFGHPQELVGACLF
LASPAASYITGASLAVDGGWTAA