Protein Info for GFF2836 in Variovorax sp. SCN45

Annotation: MotA/TolQ/ExbB proton channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 127 to 150 (24 residues), see Phobius details amino acids 174 to 195 (22 residues), see Phobius details PF01618: MotA_ExbB" amino acids 100 to 201 (102 residues), 114.8 bits, see alignment E=1.1e-37

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 96% identity to vap:Vapar_1806)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (237 amino acids)

>GFF2836 MotA/TolQ/ExbB proton channel family protein (Variovorax sp. SCN45)
MDSQFGLMNVWNQGDFVTKAVAVLLIGMSLASWIVIIVKALDVIRYKRLAKHSQDFWHSE
DFATALNKLGKDDSNPFRALALEGREAAAHHRNTKAHLHDALDVSDWITRALRNGIDAFT
ARLQTGLAILASVGSTAPFIGLFGTVWGIYHALMSIGSAGQATIDKVAGPIGEALIMTAL
GLAVAIPAVLGYNALVRGNKFVLTKLNAFAHDLHAYFVTGARVQSGSEAIVVPLKKG