Protein Info for GFF2828 in Variovorax sp. SCN45

Annotation: Uncharacterized protein CC_3059

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details PF16357: PepSY_TM_like_2" amino acids 13 to 214 (202 residues), 282.2 bits, see alignment E=2.8e-88

Best Hits

KEGG orthology group: K09939, hypothetical protein (inferred from 90% identity to vpe:Varpa_2066)

Predicted SEED Role

"FIG019175: putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>GFF2828 Uncharacterized protein CC_3059 (Variovorax sp. SCN45)
MTAAHADNRRRAYWLKTLHEWHWVSSAICLIGMILFSITGFTLNHAGQIEAKPAVTKRSG
TVDEALRAQLEKQLPAAKAEKGKAPLPAELQAWVQQHWDIATAGRDAEWSDDEIYLSLPR
PGGDAWLRLSLTDGEIEYERTDRGWLSYFNDLHKGRNTGAAWSWFIDIFAGAALVFSITG
LFILKMHAGNRPFTWPMVGMGLVVPVLLALLFIH