Protein Info for GFF2825 in Variovorax sp. SCN45

Annotation: Alkyl hydroperoxide reductase protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 TIGR03140: alkyl hydroperoxide reductase subunit F" amino acids 1 to 513 (513 residues), 789.1 bits, see alignment E=8.2e-242 PF13192: Thioredoxin_3" amino acids 120 to 195 (76 residues), 46.4 bits, see alignment E=1.2e-15 PF07992: Pyr_redox_2" amino acids 213 to 498 (286 residues), 167.3 bits, see alignment E=1.9e-52 PF12831: FAD_oxidored" amino acids 214 to 243 (30 residues), 27.5 bits, see alignment (E = 6.8e-10) PF13738: Pyr_redox_3" amino acids 262 to 483 (222 residues), 64.5 bits, see alignment E=3.6e-21 PF00070: Pyr_redox" amino acids 354 to 427 (74 residues), 51.2 bits, see alignment E=5.2e-17

Best Hits

Swiss-Prot: 71% identical to AHPF_XANCH: Alkyl hydroperoxide reductase subunit F (ahpF) from Xanthomonas campestris pv. phaseoli

KEGG orthology group: K03387, alkyl hydroperoxide reductase subunit F [EC: 1.6.4.-] (inferred from 96% identity to vpe:Varpa_2069)

MetaCyc: 62% identical to alkyl hydroperoxide reductase, AhpF component (Escherichia coli K-12 substr. MG1655)
RXN-8506 [EC: 1.5.1.37]; R4-RXN [EC: 1.5.1.37, 1.11.1.26]

Predicted SEED Role

"Alkyl hydroperoxide reductase protein F (EC 1.6.4.-)" in subsystem Thioredoxin-disulfide reductase (EC 1.6.4.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.4.-

Use Curated BLAST to search for 1.11.1.26 or 1.5.1.37 or 1.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (518 amino acids)

>GFF2825 Alkyl hydroperoxide reductase protein F (Variovorax sp. SCN45)
MLDANTKAQLKSYLERATQPIEIVASLDDSKASGEVLSLLKDVAESSPLVKLTESRDDNH
RKPSFSVNRPSENHGPRFAGLPMGHEFTSLILALLQIGGYPPKVEQAVLDQIKALDGDFE
FEIYVSLTCHNCPDVVQALNLMAVQNPRIRATMIEGGTFQDEVKERQIMAVPTVFLNGTE
FGQGRMSLEEILAKIDNSGVEREAKKIAGKDAFDVLIVGGGPAGAAAAVYAARKGIRTGV
ASERFGGQVLDTMGIENFISIKETEGPKFAHALEEHVRDYDVDIMNLQRAKALVPGQDLI
EVQLESGASLKSKTVIISTGARWRNINVPGEHEFKNKGVAYCPHCDGPLFKGKRVAVIGG
GNSGVEAAIDLAGIVGHVTLIEFDTQLRADAVLQRKLKSLKNVDIFTNAQTTEITGDQKV
NGLVFKDRATGELKTVELEGVFIQIGLVPNTDWLKGTVELSKHGEIIVDARGQTSVPGVF
AAGDATTVPFKQIIIAAGDGAKAALGAFDHLIRTSAPA