Protein Info for PS417_14415 in Pseudomonas simiae WCS417
Annotation: ABC transporter ATP-binding protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 40% identical to Y3647_BRUA2: Putative ATP-binding protein BAB2_1147 (BAB2_1147) from Brucella abortus (strain 2308)
KEGG orthology group: K02049, sulfonate/nitrate/taurine transport system ATP-binding protein (inferred from 77% identity to pau:PA14_34500)Predicted SEED Role
"Alkanesulfonates ABC transporter ATP-binding protein / Sulfonate ABC transporter, ATP-binding subunit SsuB" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A1N7U744 at UniProt or InterPro
Protein Sequence (267 amino acids)
>PS417_14415 ABC transporter ATP-binding protein (Pseudomonas simiae WCS417) MTHAVLSAQGICLGYASGPVLQGFDLHLQPGEVVSILGPSGVGKSSLLRVLAGLQAPQGG SVRVLGEPLNGPHPRVAVAFQDPSLLPWLNLEKNVAFGLDFARQPHLDHDERRRRIDHAI AAVGLEQARQQFPAQLSGGMAQRTALARCLARQPQVLLLDEPFGALDEVTRADMQHLLLK VNREQGSAAVLITHDIDEALLLSDRILLLGNRPARTLGEWLIDLPQPREEQVEAIGALRI DILKTLRQASRPQSNPLDLLEPVHVPG