Protein Info for PS417_14410 in Pseudomonas simiae WCS417

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details PF10518: TAT_signal" amino acids 9 to 27 (19 residues), 26.2 bits, see alignment (E = 7.9e-10) TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 9 to 27 (19 residues), 20.2 bits, see alignment (E = 2.8e-08) PF13379: NMT1_2" amino acids 39 to 278 (240 residues), 153.3 bits, see alignment E=1.7e-48 PF09084: NMT1" amino acids 52 to 274 (223 residues), 21 bits, see alignment E=4.1e-08

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 86% identity to pfl:PFL_3182)

Predicted SEED Role

"Nitrate ABC transporter, nitrate-binding protein" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TZQ9 at UniProt or InterPro

Protein Sequence (399 amino acids)

>PS417_14410 ABC transporter substrate-binding protein (Pseudomonas simiae WCS417)
MCLDDLTHSRRDFLKLSAVLSAAGALPLLSSLQARAASEPDAPVRIGYLPITDATPLLVA
HNNGLFEAEGIKAERPVLLRSWAQVIEAFISGQVNVIHLLSPMTVWARYGSKVPAKVVAW
NHVGGSGLTVAPGITDVKQLGGKSVAIPFWYSIHNVVVQQLFRDNGLTPVARAAGSVIAA
NEVNLIVLPPSDMPPALASQRIDGYIVAEPFNALAENLKVGRVQRFTGDVWRNHACCVVF
MHEHDLANRPQWSQKVVNAIVKAQVWTRDNREEAVKLLSKDGPNRYTPHAEPVLSKVLAP
AAGDRAAYLADGAIQHGNWDEHRIDFQPYPFPSYTEELVRRLKDTLIEGDKKFLADLDPA
FVAKDLVDDRFVRNAIEAVGGMKTFGLPDGYERHEEIGV