Protein Info for GFF2822 in Xanthobacter sp. DMC5

Annotation: Anaerobic nitric oxide reductase transcription regulator NorR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 PF00158: Sigma54_activat" amino acids 153 to 321 (169 residues), 221.5 bits, see alignment E=2.6e-69 PF14532: Sigma54_activ_2" amino acids 154 to 325 (172 residues), 62.5 bits, see alignment E=2.6e-20 PF01078: Mg_chelatase" amino acids 175 to 276 (102 residues), 26.8 bits, see alignment E=1.5e-09 PF00004: AAA" amino acids 177 to 297 (121 residues), 22.5 bits, see alignment E=6.3e-08 PF07728: AAA_5" amino acids 177 to 295 (119 residues), 22.3 bits, see alignment E=5.3e-08 PF25601: AAA_lid_14" amino acids 326 to 403 (78 residues), 71.9 bits, see alignment E=1.4e-23 PF02954: HTH_8" amino acids 419 to 459 (41 residues), 44.4 bits, see alignment 4.9e-15

Best Hits

KEGG orthology group: None (inferred from 75% identity to azc:AZC_3213)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (462 amino acids)

>GFF2822 Anaerobic nitric oxide reductase transcription regulator NorR (Xanthobacter sp. DMC5)
MTTIADERFAAARALLGMVEGMIDGATLVDRESRVVWFSEGQLALLGKTDLAELVGQEIE
RVIPHSRMREVVETGHPHPLDIIQYGDRWLLVTRLPLRDETGAIIGAIAFALKDSIPYLR
PIAERLHQMQSRLSRMEQAFSAKRAVRFTAEHILGASPAMRKLARLLRRAGEVGSAVLLL
GETGTGKEMAAHAIHAASKRMSRPFVAINVAAVPENLLEAEFFGVAPGAFTGAARQPRPG
KFQIAHEGTLFLDEIGDMPLALQAKLLRTLQDGEVEPVGSNQPSRVDVRIIAATSRPLAD
MVRAGTFRQDLYYRLNVLPIHLPPLRERAGDVELLATRFSEQTAAAFGVAVRPLTAGAVA
RLERHDWPGNVRELANVIEQIYVRSDGARIEASHVADVLPSPPEAAAEAAPDLDLAAAVA
RLERTMMADALAQAGGNKREAAARLGLSRSSLYAKIRQYGMG