Protein Info for PS417_14405 in Pseudomonas simiae WCS417

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 37 to 50 (14 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 169 to 185 (17 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 80 to 249 (170 residues), 89.1 bits, see alignment E=1.6e-29

Best Hits

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 84% identity to pfl:PFL_3181)

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UA53 at UniProt or InterPro

Protein Sequence (253 amino acids)

>PS417_14405 ABC transporter permease (Pseudomonas simiae WCS417)
MNNRELPGWLLGLSGLAGLLLLWWLGVKVFGATDGLSARFSVAATFTSLWELLGRGELYL
HIAVSLKRIFVGLFLALLVGVPLGLVVGSSRKLEAATTPAFQFLRMISPLSWMPIVVMLM
GVGDQPIYFLLAFAAVWPIMLNTAAGVRQLDPRWLQLSSSLSATRWETLRRVIIPGVVGH
VLTGVRLAIGILWIVLVPCEMLGVSAGLGYYILDTRDRLAYSELMAMVLLIGLLGFALDA
LARWLHQRWVHTG