Protein Info for GFF2821 in Variovorax sp. SCN45

Annotation: Hemin ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 65 to 84 (20 residues), see Phobius details amino acids 95 to 119 (25 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 252 to 277 (26 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details PF01032: FecCD" amino acids 17 to 338 (322 residues), 292.5 bits, see alignment E=1.7e-91

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 92% identity to vpe:Varpa_2074)

Predicted SEED Role

"Hemin ABC transporter, permease protein" in subsystem Hemin transport system or Iron acquisition in Vibrio or Putative hemin transporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (344 amino acids)

>GFF2821 Hemin ABC transporter, permease protein (Variovorax sp. SCN45)
MTQRFSARAVLGGSALLLVAAFVAGAVSGAYAISLSQLWNVLMTLGQGADKSPEHLVFLN
IRLPRLVLGVAAGAGLGMAGTLMQGLFRNPLADPGLVGISSGAALAAGVTIVLGAWFWPV
LPRTLGSWTLVLMAFGGGLSVTLLIYGLSRSEGGTRMALMLLAGIAVNALAGAGLGFLSV
MATDEQLRSLQFWLLGSLGGARWSAVLLVAAAVALACVAARSLAAPLNAIALGEAQAALL
GVDVERTKRRAIVVTAVAVGAVTATTGIIGFIGLIAPHWVRMVAGPDHRVVLPASALLGA
ALVLAADTVARTVMAPAELPLGVLTAFIGVPMFLWMLRHFKGRI