Protein Info for GFF2820 in Xanthobacter sp. DMC5

Annotation: putative enoyl-CoA hydratase echA8

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF00378: ECH_1" amino acids 12 to 256 (245 residues), 270.1 bits, see alignment E=1.8e-84 PF16113: ECH_2" amino acids 14 to 246 (233 residues), 132.6 bits, see alignment E=2.4e-42

Best Hits

Swiss-Prot: 59% identical to ECHA8_MYCTU: Probable enoyl-CoA hydratase echA8 (echA8) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 86% identity to xau:Xaut_0908)

MetaCyc: 56% identical to short chain enoyl-CoA hydratase subunit (Bos taurus)
METHYLACYLYLCOA-HYDROXY-RXN [EC: 4.2.1.150]; 4.2.1.150 [EC: 4.2.1.150]

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.150 or 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>GFF2820 putative enoyl-CoA hydratase echA8 (Xanthobacter sp. DMC5)
MTYESILTATDGAVGIITLNRPEALNALNSRITAELSQAAAAFDADPAIGAIVVTGSERA
FAAGADIKEIKDKTFAEVYEEQLITATWEGLSRVRKPTIAAVSGHAIGGGCEVALMCDII
IASETARFALPETTIGIIPGAGGTQRLTRIVGKAVAMDMILTGRALSAQEALAMGLVSRV
VPAGTYVAEAVAIAARISASSGPVVRLAKEAVNQAYETHLQEGLYVERRLLYATFALEDR
REGMNAFAEKRKPIFRGL