Protein Info for GFF2819 in Pseudomonas sp. DMC3

Annotation: Putative transport protein YdiK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 39 to 56 (18 residues), see Phobius details amino acids 68 to 92 (25 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 248 to 276 (29 residues), see Phobius details amino acids 281 to 298 (18 residues), see Phobius details amino acids 315 to 345 (31 residues), see Phobius details PF01594: AI-2E_transport" amino acids 24 to 348 (325 residues), 91.3 bits, see alignment E=3.5e-30

Best Hits

KEGG orthology group: None (inferred from 60% identity to bph:Bphy_6456)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>GFF2819 Putative transport protein YdiK (Pseudomonas sp. DMC3)
MEDKPLIAFNSSKALLDVLIRAGLIATLVLFCYDIFHPFLNVMLWALILAVTLYPLNQKL
GAKLGNRYGWAAIVLVLLGLVILMVPLSLLGASVADSVKVGMQTVEAGQFEIPQPPANVA
DWPLIGAPLYGIWMHASQDLSWVFKELAPHLTSWGRVLLHQAAGVGAGIVVFVVALIVAG
LIMTHGERGHRTAVAITTRISGPVRGPQIAQLCTSTIRAVAQGVVGIAFIQMILIGVALV
SMGVPAAGVLALMVLLLGIMQLPVLLVTVPVVVFVFAHDGVGPGTIIFAVWMVIAGLSDN
VLKPMLLGRGVAVPMPVVLIGALGGMVTSGIIGLFTGPVILAVGYELFIGWVYQPADVSE
VLDETSHDNQP