Protein Info for GFF2817 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: LSU ribosomal protein L24p (L26e)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01079: ribosomal protein uL24
  • amino acids 1 to 103 (103 residues), 118.9 bits, E=6e-39
• PF00467: KOW
  • amino acids 7 to 36 (30 residues), 31.6 bits, E=1.1e-11
• PF17136: ribosomal_L24
  • amino acids 38 to 103 (66 residues), 91.7 bits, E=3e-30

Best Hits

Swiss-Prot: 83% identical to RL24_POLSJ: 50S ribosomal protein L24 (rplX) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K02895, large subunit ribosomal protein L24 (inferred from 83% identity to pol:Bpro_0486)

MetaCyc: 62% identical to 50S ribosomal subunit protein L24 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L24p (L26e)" in subsystem Ribosome LSU bacterial

Protein Sequence (106 amino acids)

>GFF2817 LSU ribosomal protein L24p (L26e) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MNKIRSGDEVIVIAGRDKGKRGKVLQRSDDSRLVVEGVNLVKKHAKPNPMKGITGGIIEK
TMPIHQSNVAIFNGATGKADRVGIKLLADGKKVRVFKSSGEEIKVA