Protein Info for GFF2816 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Septum site-determining protein MinC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 PF05209: MinC_N" amino acids 6 to 75 (70 residues), 73.5 bits, see alignment E=1.3e-24 TIGR01222: septum site-determining protein MinC" amino acids 6 to 234 (229 residues), 230.3 bits, see alignment E=1.3e-72 PF03775: MinC_C" amino acids 132 to 231 (100 residues), 109.5 bits, see alignment E=8.1e-36

Best Hits

Swiss-Prot: 100% identical to MINC_SALTY: Septum site-determining protein MinC (minC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03610, septum site-determining protein MinC (inferred from 100% identity to set:SEN1223)

Predicted SEED Role

"Septum site-determining protein MinC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>GFF2816 Septum site-determining protein MinC (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSNTPIELKGSSFTLSVVHLHEAEPEVIRQALEDKIAQAPAFLKHAPVVINVSGLESPVN
WPELHKIVTSTGLRIIGVSGCKDASLKVEIDRMGLPLLTEGKEKAVRPAPVEPATPSEPP
QNANPITKTRLIDVPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAG
ASGDREAQIFCTHLTAELVSIAGVYWLSDKIPAEFYGKAARLRLADNALTVQPLN