Protein Info for GFF2808 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02600: DsbB
  • amino acids 2 to 142 (141 residues), 146 bits, E=5.8e-47

Best Hits

Swiss-Prot: 100% identical to DSBB_SALTI: Disulfide bond formation protein B (dsbB) from Salmonella typhi

KEGG orthology group: K03611, disulfide bond formation protein DsbB (inferred from 99% identity to sew:SeSA_A1949)

MetaCyc: 84% identical to protein thiol:quinone oxidoreductase DsbB (Escherichia coli K-12 substr. MG1655)
RXN-19950 [EC: 1.8.5.9]

Predicted SEED Role

"Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

MetaCyc Pathways

• periplasmic disulfide bond formation (1/3 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.5.9

Protein Sequence (159 amino acids)

>GFF2808 Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAFTALALEMVALWFQHVMLLKPCVLCIYERCALFGVMGAGLVGAIAPKTPLRYVAMVIW
IYSAWRGLQLAYEHTMIQLHPSPFMTCDFMARFPDWLPLGKWLPQVFVASGDCAERQWSF
LTLEMPQWLLGIFAAYLVVAIAVVIAQAFKPKKRDLFGR