Protein Info for GFF2802 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ATP-dependent DNA helicase RecG (EC 3.6.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 698 transmembrane" amino acids 362 to 379 (18 residues), see Phobius details PF17191: RecG_wedge" amino acids 15 to 155 (141 residues), 30.8 bits, see alignment E=6.3e-11 TIGR00643: ATP-dependent DNA helicase RecG" amino acids 28 to 670 (643 residues), 662.6 bits, see alignment E=3.6e-203 PF01336: tRNA_anti-codon" amino acids 56 to 127 (72 residues), 27.1 bits, see alignment E=1e-09 PF00270: DEAD" amino acids 279 to 437 (159 residues), 75.5 bits, see alignment E=1.3e-24 PF04851: ResIII" amino acids 281 to 432 (152 residues), 30.2 bits, see alignment E=1.2e-10 PF00271: Helicase_C" amino acids 480 to 588 (109 residues), 58.2 bits, see alignment E=2.9e-19 PF19833: RecG_dom3_C" amino acids 621 to 679 (59 residues), 42.6 bits, see alignment 1.5e-14

Best Hits

KEGG orthology group: K03655, ATP-dependent DNA helicase RecG [EC: 3.6.4.12] (inferred from 75% identity to ajs:Ajs_0376)

Predicted SEED Role

"ATP-dependent DNA helicase RecG (EC 3.6.1.-)" in subsystem DNA-replication (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-, 3.6.4.12

Use Curated BLAST to search for 3.6.1.- or 3.6.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (698 amino acids)

>GFF2802 ATP-dependent DNA helicase RecG (EC 3.6.1.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPDANPDRKPLSAPQKALHKLGLVRDIDLALHLPLRYEDETRIVSLRGARDGQLAQIEGT
VTHSEISFRPRRQLLVTLDDGTDTCTLRFFTFYPAHQKTLAVGARVRVRGELRGGFAGWS
MVHPAFHLAGGELPDALTPVYPTSAQLPQAYIRKAAAGGLKRADLSETLPPALLGGLQAV
VRGTWTLRDALQYLHHPGPDVSLDALEDRSHPAWQRLKAEELLAQQLSQFTAKQERAALR
APVLRAAPGGLHEQLLGALPFALTGAQRRVGEEIARDLLRQVPMHRLLQGDVGSGKTVVA
ALAAAIAIDAGWQCALMAPTEILAEQHFAKLIGWLEPLLAPLGKRVAWLTGSQKKKQRGE
MLVLIASGEAALVVGTHAVIQDQVVFKHLALAIIDEQHRFGVAQRLALRSKVGVAADGTE
QEPHLLMMTATPIPRTLAMSYYADLDVSTIDELPPGRTPIVTKVVADSRRAEVIERIRGQ
LAQGRQVYWVCPLIEESEAIDLSNATATHAELSASLPGVLVGLLHSRMPVAEKKAVMSLF
TGGQMGVLVSTTVIEVGVDVPNASLMVIEHAERFGLSQLHQLRGRVGRGAAASACVLMYT
PPDGGRLGETARERLRAMADTSDGFEIARRDLEIRGPGEFLGARQSGAPLLRFADLATDG
HLLDWAREAAPVMLAQYPAAAEKHIARWLGGKAEYLKA