Protein Info for GFF28 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Copper homeostasis protein CutF precursor / Lipoprotein NlpE involeved in surface adhesion

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF04170: NlpE" amino acids 45 to 129 (85 residues), 95.6 bits, see alignment E=1.3e-31

Best Hits

Predicted SEED Role

"Copper homeostasis protein CutF precursor / Lipoprotein NlpE involeved in surface adhesion" in subsystem Copper homeostasis: copper tolerance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (176 amino acids)

>GFF28 Copper homeostasis protein CutF precursor / Lipoprotein NlpE involeved in surface adhesion (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MVRTAILSVAAACTLFALIGCNNRAEVDALQPAQAAELKPMQQSWRGVLPCADCEGIETS
LFLEKDGTWVMNERYQGVREEPSSFASYGTWARTADKLVLTDSNGEKSYYRAKGNALEML
DREGNPVASQLNYTLVPVTASLPVTPMPLRGMYVCIQGRCGDLYRLRDRKTAAGRQ