Protein Info for GFF2789 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Ni,Fe-hydrogenase I cytochrome b subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 61 to 88 (28 residues), see Phobius details amino acids 108 to 123 (16 residues), see Phobius details amino acids 136 to 159 (24 residues), see Phobius details amino acids 165 to 182 (18 residues), see Phobius details amino acids 194 to 211 (18 residues), see Phobius details TIGR02125: Ni/Fe-hydrogenase, b-type cytochrome subunit" amino acids 20 to 233 (214 residues), 241 bits, see alignment E=4.7e-76 PF01292: Ni_hydr_CYTB" amino acids 22 to 228 (207 residues), 116.3 bits, see alignment E=7.5e-38

Best Hits

Swiss-Prot: 83% identical to CYBH_ECO57: Probable Ni/Fe-hydrogenase 1 B-type cytochrome subunit (hyaC) from Escherichia coli O157:H7

KEGG orthology group: K03620, Ni/Fe-hydrogenase 1 B-type cytochrome subunit (inferred from 98% identity to ses:SARI_01150)

MetaCyc: 83% identical to hydrogenase 1 cytochrome b subunit (Escherichia coli K-12 substr. MG1655)
1.12.98.-; Hydrogen:quinone oxidoreductase. [EC: 1.12.5.1]

Predicted SEED Role

"Ni,Fe-hydrogenase I cytochrome b subunit" in subsystem Hydrogenases or Membrane-bound Ni, Fe-hydrogenase

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>GFF2789 Ni,Fe-hydrogenase I cytochrome b subunit (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTGKLSPRVGEARDTAVSHYVFEAPVRLWHWLTVACMLVLMVTGYFIGRPLPSVSGEATY
LFYMGYIRLIHFAAAMIFTVLLLGRIYWACVGNRYSRELFIVPVWRRSWWQGAFTVVRWY
LFLEKKPGSDIGHNPVAQAAMFGYFLLSVFMILTGFALFGEHSQYAIFAPFRYVVEFFYW
TGGNSIDIHSWHRLGMWLIAAFIVGHVYLAIREDIMSDDTVISTMINGYRSHKFPKPHDK
EPS