Protein Info for GFF2786 in Variovorax sp. SCN45

Annotation: Sulfate transporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 575 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 143 to 164 (22 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 248 to 271 (24 residues), see Phobius details amino acids 323 to 347 (25 residues), see Phobius details amino acids 353 to 371 (19 residues), see Phobius details amino acids 378 to 398 (21 residues), see Phobius details amino acids 403 to 421 (19 residues), see Phobius details PF00916: Sulfate_transp" amino acids 31 to 391 (361 residues), 248.1 bits, see alignment E=1.3e-77 PF01740: STAS" amino acids 455 to 539 (85 residues), 36.9 bits, see alignment E=2.8e-13

Best Hits

KEGG orthology group: None (inferred from 94% identity to vpe:Varpa_2125)

Predicted SEED Role

"Sulfate permease family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (575 amino acids)

>GFF2786 Sulfate transporter family protein (Variovorax sp. SCN45)
MNPATTSPSLRQRLSRWVPCLAWPRPSAALLRNEAMAGITVALMVIPQGVAYAALAGMPL
VTGVYAALFPALIAVMFSSSQRLSVGPTALTSLLVGASLAPLAVAGSAEWVAMAVWLTLM
SGTIQIVLGAGRFGWLLRLVNSPVLIGFTQGAAVLIAISQLPALLGFTGRTIPQVLHGGP
LPDLVAIAFGLGSIAVLWLGKRMLPRFPTTMALVAGAAAISWAIDYALRGGAVVGSLPSG
LPSFYWPGLLPMSTLGALVLPALMITLVSFLETASSAKVDNARAGTLWNENQDLIGQGLA
KLASGFSGAFPTSSSFSRSAITLYAGAQTGWATLFSVVVVAGALLWLMPLLYHVPQAVLA
AVVVTAILGLVKPASFTALWRISRIEAGIAFGTFVLTIATAPSIYWGVLGGLLAALAHYM
YRHLHPRIIEVGLHPDGSLRDRNLWKLPPLAPQLYALRMDAELDFASASTLERALTVALA
ERPGLTDVCLFAQPINRIDITGAEVFGSIRRMMEAKGIRLHLSGMKLPAMQVLESAGLLA
PGPMLFSYRTDGEALAALMPRVDVPVTSAETESAA