Protein Info for GFF2784 in Pseudomonas sp. DMC3

Annotation: Inner membrane protein RclC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 191 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details PF04224: DUF417" amino acids 9 to 185 (177 residues), 236.1 bits, see alignment E=9.8e-75

Best Hits

Swiss-Prot: 74% identical to RCLC_ECOLI: Inner membrane protein RclC (rclC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 73% identity to ecc:c0418)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (191 amino acids)

>GFF2784 Inner membrane protein RclC (Pseudomonas sp. DMC3)
MFTSINAGLQQLGKLDRLGIPLMRVAIAIVFLWIGALKFVPYEADSITPFVANSPVMSFF
YEHPQDYKAHLTHEGELNADRRAWQTANNTYGFSTGLGVVEILIGLLVLSNPLSRRTGLL
GGALAFATPLVTLSFLVTTPEAWVAALGDGQHGFPYLSGAGRLVLKDVLMLAGALPVMAD
SARQLLTERQA