Protein Info for GFF2780 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Pyruvate kinase (EC 2.7.1.40)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00224: PK
  • amino acids 3 to 329 (327 residues), 366.8 bits, E=9.7e-114
• TIGR01064: pyruvate kinase
  • amino acids 4 to 473 (470 residues), 508 bits, E=1.1e-156
• PF02887: PK_C
  • amino acids 362 to 473 (112 residues), 119.5 bits, E=8.5e-39

Best Hits

KEGG orthology group: K00873, pyruvate kinase [EC: 2.7.1.40] (inferred from 83% identity to pol:Bpro_4634)

Predicted SEED Role

"Pyruvate kinase (EC 2.7.1.40)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.1.40)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• Rubisco shunt (10/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (15/17 steps found)
• Entner-Doudoroff pathway I (9/9 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (7/7 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• homolactic fermentation (10/12 steps found)
• Bifidobacterium shunt (12/15 steps found)
• glycolysis IV (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• superpathway of glucose and xylose degradation (13/17 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (20/27 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (6/9 steps found)
• mixed acid fermentation (11/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (13/19 steps found)
• heterolactic fermentation (12/18 steps found)
• glycerol degradation to butanol (10/16 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (4/9 steps found)
• superpathway of N-acetylneuraminate degradation (13/22 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Glycolysis / Gluconeogenesis
• Purine metabolism
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.40

Protein Sequence (477 amino acids)

>GFF2780 Pyruvate kinase (EC 2.7.1.40) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSMRATKIVATLGPASSDPDLLERMIRAGVNVVRLNFSHGTAQDHIDRAELVRAAAQRAG
REVGIMADLQGPKIRVGKFAQGKVMLEPGMPFVLDASRTEPGDLEGVGLDYKELPRDVKA
GDTLLLNDGLIVLTINKVVGPAVHTTVKLGGELSNNKGINKQGGGLTAPALTAKDMDDIK
TAMGLKADYVAVSFPKNATDMELARQLCNVAGAALAHKPALIAKIERAEAIPELAAILKV
SDGIMVARGDLAVEVGNAAVPGLQKHMIRLAREMDKVVITATQMMESMIVNPVPTRAEVS
DVANAVLDGTDAVMLSAETAAGRFPLETVMEMANICSEAEKAEYRELSADFQGKTFKRID
QSIAMGALFTAHHLGAKAIVALTDSGSTALWMSRHNVRMPIYAMTPNLSTQRRMTLYRNV
RPLLMDNSTDRDSALLDAEAHLKKRGIVQTGDVYAITVGEPMGQPGGTNTLKICRAA