Protein Info for GFF2777 in Variovorax sp. SCN45

Annotation: Uncharacterized UPF0721 integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details PF01925: TauE" amino acids 9 to 238 (230 residues), 105.7 bits, see alignment E=1.5e-34

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 90% identity to vpe:Varpa_2134)

Predicted SEED Role

"putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>GFF2777 Uncharacterized UPF0721 integral membrane protein (Variovorax sp. SCN45)
MQALYVSVIAGAVLAGFVQGLSGFAFGLVAMSVWAWTLEPQLAALLALFGALTGQVIAAL
TVRRAFDKRVLWPFVIGGLVGVPFGVWLLPHLDLVVFKLCLGVLLVLWCPAMLMSQHLPK
VSFGGRVADGVAGTIGGVMAGIGGFSGTIPTLWCTLRGFQRDTQRAVIQNFNLSMLAVAF
AIHLASGSIERSTVPLLGVVALAVAVPVLLGARLYVGISEAAFRKLVLSLLTASGVAMLA
SAVPAILQRS