Protein Info for GFF2774 in Variovorax sp. SCN45

Annotation: Auxin efflux carrier family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 50 to 66 (17 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 116 to 133 (18 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 172 to 195 (24 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 232 to 255 (24 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details PF03547: Mem_trans" amino acids 160 to 308 (149 residues), 43.6 bits, see alignment E=7.7e-16

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 90% identity to vpe:Varpa_2135)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>GFF2774 Auxin efflux carrier family protein (Variovorax sp. SCN45)
VDYPWSVRFILDAVNYAQLLFPDFSLIAIGWLLCRYTALDRRVWDQVESLVYYFLFPVLL
FHSIVRSPLDFGATSNLLIAGLCIGAVGIALAYALPFVPGIGSHIDRRDHAASAQVAFRF
NSFICLALAERLAGSEGLLLIAVLIGVCVPIFNIAAVWPMTRHAQTGFVQQLVRNPLIVA
TVAGLLANVLGLTVPNWATPTLTRIGAASLALGLLAAGAGMKFSTLGTGKMLAVSILAIR
HLILPLVAWGLALALRLDAMQASVLMAFSAVPTASSAYVLAARMGYNGPYVAGLVTLSTL
LGVLSLPFALALPR