Protein Info for GFF2773 in Xanthobacter sp. DMC5

Annotation: 3-hydroxyisobutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03446: NAD_binding_2" amino acids 3 to 162 (160 residues), 169.1 bits, see alignment E=1.2e-53 PF03807: F420_oxidored" amino acids 3 to 69 (67 residues), 34.7 bits, see alignment E=3.3e-12 TIGR01692: 3-hydroxyisobutyrate dehydrogenase" amino acids 6 to 293 (288 residues), 363.9 bits, see alignment E=3e-113 PF14833: NAD_binding_11" amino acids 165 to 287 (123 residues), 102.7 bits, see alignment E=2.5e-33

Best Hits

Swiss-Prot: 58% identical to MMSB_PSEAE: 3-hydroxyisobutyrate dehydrogenase (mmsB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00020, 3-hydroxyisobutyrate dehydrogenase [EC: 1.1.1.31] (inferred from 57% identity to pau:PA14_18140)

MetaCyc: 47% identical to 3-hydroxyisobutyrate dehydrogenase subunit (Pseudomonas putida)
3-hydroxyisobutyrate dehydrogenase. [EC: 1.1.1.31]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.31

Use Curated BLAST to search for 1.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>GFF2773 3-hydroxyisobutyrate dehydrogenase (Xanthobacter sp. DMC5)
MSRIAFLGIGNMGFPMAANLVRAGHEVHAFDISIEARQRIAALGARAAESPLEAAEGADM
VITMVPNSRAVTDLYLGPAGLLAKLQSRPFLVDCSTIAPEAARDVASAAGRAGFTMLDAP
VSGGVHRAAEGTLSFMVGGTEDALAQARPVLEQMGRFVFHAGGSGAGQAAKICNNMLAAV
TMAATAEVMELGARNGLDAAVLTAIMQKSSGGNFFLERWHPWPNVLPDSPSSKGYAAGFQ
LALMLKDLGLALDSARANGAAVPLGALAQSLYALRSKEDGAPALDFSCIQTLYTHQA