Protein Info for GFF2772 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: FIG000875: Thioredoxin domain-containing protein EC-YbbN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF00085: Thioredoxin" amino acids 12 to 114 (103 residues), 98.9 bits, see alignment E=4.6e-32 TIGR01068: thioredoxin" amino acids 18 to 115 (98 residues), 109.2 bits, see alignment E=4.9e-36 PF13098: Thioredoxin_2" amino acids 29 to 112 (84 residues), 32.5 bits, see alignment E=2.8e-11 PF13905: Thioredoxin_8" amino acids 30 to 74 (45 residues), 27.7 bits, see alignment 8.8e-10 PF14559: TPR_19" amino acids 131 to 195 (65 residues), 43.7 bits, see alignment E=8.5e-15 PF14561: TPR_20" amino acids 212 to 287 (76 residues), 62.8 bits, see alignment E=9.2e-21

Best Hits

KEGG orthology group: K05838, putative thioredoxin (inferred from 68% identity to adn:Alide_4127)

Predicted SEED Role

"FIG000875: Thioredoxin domain-containing protein EC-YbbN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>GFF2772 FIG000875: Thioredoxin domain-containing protein EC-YbbN (Hydrogenophaga sp. GW460-11-11-14-LB1)
VDFTFAQAAPMINVTVANFEAEVIEASMNTPVLVDFWAPWCGPCKVIGPLLEKLEADYAG
RFKLVKIDSDQEQQLAAAFGIRSIPTCVLLKNGQPVDGFMGAMPEGQIKAFLDKHLPAGE
EPEAEEAQPDALAEGDLEGALDQMRQTVQAEPDNDDARFDLVKLLLEMGQDDDAKVAFAP
VIAKAAGVRRLDSLQRWMAARDAQAEVADPDARAAELQAAIAANKRDFESRFALAQLLMA
YGQWTVAMDELLEILMRDKTWKEDLARKTFIAILDVIDPPKPKVAEGQVPPEDPTVATYR
RRLSSVVLS