Protein Info for GFF2771 in Pseudomonas sp. DMC3

Annotation: Trk system potassium uptake protein TrkI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 transmembrane" amino acids 9 to 34 (26 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 326 to 348 (23 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details amino acids 394 to 417 (24 residues), see Phobius details amino acids 427 to 442 (16 residues), see Phobius details amino acids 457 to 482 (26 residues), see Phobius details PF02386: TrkH" amino acids 46 to 478 (433 residues), 180.3 bits, see alignment E=2.7e-57

Best Hits

KEGG orthology group: K03498, trk system potassium uptake protein TrkH (inferred from 86% identity to pba:PSEBR_a3297)

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (484 amino acids)

>GFF2771 Trk system potassium uptake protein TrkI (Pseudomonas sp. DMC3)
MSLAAIRLIGFILGIFLITLAVSMAIPMMTLVVYEHSDDLSAFLWSSLITFICGLLLIVR
GRPETGNLRPRDMYLLTTASWVVVCAFAALPMVFISDISYTDAFFETMSGITTTGSTVLT
GLDSASPGLLIWRSMLHWLGGIGFIGMAVAILPLLRVGGMRLFQTESSDWSEKVTPRSHV
AAKYILLLYLGLTGIGTLALWLAGMTPFEAINHAMSLISTGGFSTSDSSLGHWQQPAIHW
VAVVIMILGSLPFTLYVATCRGNRRALIRDHQVRGFIGFLLVTSLAVGTWLYFHSDYGWW
DAFRIVAVNVTSVVTTTGIAVGDYTLWGSFAVLLFFYLTFVGGCSGSTAGGLKIFRFQVA
AALLVSSLKQLIHPRAVIQKKYNGHPIDEEIVRSLLTFSFFFTITIAAIALGLALIGLDW
ITALSGAATAVCNVGPGLGTIIGPAGNFSSLPDAAKWLLTVGMLLGRLEILTVLVLVTPV
FWRY