Protein Info for PS417_14105 in Pseudomonas simiae WCS417

Annotation: 6-O-methylguanine DNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF02805: Ada_Zn_binding" amino acids 8 to 68 (61 residues), 98.9 bits, see alignment E=2.7e-32 PF00165: HTH_AraC" amino acids 92 to 126 (35 residues), 34.9 bits, see alignment 2.5e-12 PF12833: HTH_18" amino acids 102 to 178 (77 residues), 62.6 bits, see alignment E=6.9e-21 TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase" amino acids 266 to 345 (80 residues), 111.9 bits, see alignment E=5.6e-37 PF01035: DNA_binding_1" amino acids 267 to 346 (80 residues), 118.1 bits, see alignment E=2.4e-38

Best Hits

Swiss-Prot: 51% identical to ADA_ECOLI: Bifunctional transcriptional activator/DNA repair enzyme Ada (ada) from Escherichia coli (strain K12)

KEGG orthology group: K10778, AraC family transcriptional regulator, regulatory protein of adaptative response / methylated-DNA-[protein]-cysteine methyltransferase [EC: 2.1.1.63] (inferred from 93% identity to pfs:PFLU2975)

MetaCyc: 51% identical to DNA-binding transcriptional dual regulator / DNA repair protein Ada (Escherichia coli K-12 substr. MG1655)
2.1.1.M37 [EC: 2.1.1.M37]; Methylated-DNA--[protein]-cysteine S-methyltransferase. [EC: 2.1.1.M37, 2.1.1.63]; 2.1.1.63 [EC: 2.1.1.M37, 2.1.1.63]

Predicted SEED Role

"ADA regulatory protein / Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63)" in subsystem DNA repair, bacterial (EC 2.1.1.63)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.63

Use Curated BLAST to search for 2.1.1.63 or 2.1.1.M37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7ULB7 at UniProt or InterPro

Protein Sequence (350 amino acids)

>PS417_14105 6-O-methylguanine DNA methyltransferase (Pseudomonas simiae WCS417)
MMTEQDPRWAAILARDPKADALFVYGVKTTGVYCRPSSASRLPRPENIEFFDTAAQAEAA
GYRASKRAAGDQTQLVAHHAQLVADACRRIEQADTPPSLNALAMQANLSPFHFHRVFKAV
TGLTPKGYASAHRSRKVRDGLKASHSVTEALYDAGFNSNSRFYESADQLLGMKPSDYKAG
GTNTAILFAVGQCTLGAILVAQSARGVCAILLGDDPDQLVRDLQDQFPKAELVGADQRFE
QCVAQVVGFIEAPALGLDLPLDLRGTAFQERVWQALRDIPPGSTASYAQVAARIGAPKSF
RAVAQACGANSLAVAIPCHRVVRSNGDLSGYRWGVERKQQLLAREQLPKA