Protein Info for GFF2764 in Variovorax sp. SCN45

Annotation: Carbonic anhydrase-like protein MJ0304

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00132: Hexapep
  • amino acids 88 to 122 (35 residues), 39.6 bits, 2.8e-14
• PF14602: Hexapep_2
  • amino acids 90 to 122 (33 residues), 24.1 bits, 2.5e-09

Best Hits

Swiss-Prot: 59% identical to Y3753_PSEAE: Uncharacterized protein PA3753 (PA3753) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 82% identity to vpe:Varpa_2153)

MetaCyc: 39% identical to 2-hydroxycyclohepta-1,4,6-triene-1-carboxyl-CoA thioesterase (Escherichia coli K-12 substr. MG1655)
3.1.2.-

Predicted SEED Role

"carbonic anhydrase, family 3"

Protein Sequence (174 amino acids)

>GFF2764 Carbonic anhydrase-like protein MJ0304 (Variovorax sp. SCN45)
MAIYELDGIAPTLGEGTWVADSAQVMGNVKLADNASVWFGAVLRGDTETLTIGRNSNVQD
LSVLHADIGCPLTIGDNVTVGHQVMLHGCTIGDNSLIGIQAVVLNNAKIGRNSIVGAGSV
VTEGKEFPDNSLIIGSPAKVVRTLDDAAAARLRQSAEHYVENAHRFAKGLKKIA