Protein Info for GFF2761 in Variovorax sp. SCN45

Annotation: Glutamine ABC transporter, permease protein GlnP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 54 to 78 (25 residues), see Phobius details amino acids 90 to 112 (23 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 110 (99 residues), 99.5 bits, see alignment E=6.5e-33 PF00528: BPD_transp_1" amino acids 37 to 216 (180 residues), 74.4 bits, see alignment E=5e-25

Best Hits

Swiss-Prot: 59% identical to GLNP_ECOL6: Glutamine transport system permease protein GlnP (glnP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K10037, glutamine transport system permease protein (inferred from 88% identity to vei:Veis_1707)

MetaCyc: 59% identical to L-glutamine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>GFF2761 Glutamine ABC transporter, permease protein GlnP (Variovorax sp. SCN45)
MDFDWSVIAGALPALAKGARLTVLITVAGLLGGTLLGVLFGLMRAYGNRLVGGLGFAYVG
LVRGTPIVVQVMFIYFALPGLLGVRVDPMTAAIASIVINSGAYIAEIVRGAFLSVPKGLS
EAGLAMGLPRWRVLAFVVGPVAFRRMTPALGNQFIVSLKDTSLFIVIGVGELTRQGQEIM
AANFRAIEIWTAVAVIYLMLIGVLTLALRTVEKRMRIL