Protein Info for GFF2758 in Xanthobacter sp. DMC5

Annotation: 2,3-dimethylmalate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13714: PEP_mutase
  • amino acids 12 to 247 (236 residues), 145.4 bits, E=2.3e-46
• PF00463: ICL
  • amino acids 79 to 158 (80 residues), 41.2 bits, E=8.4e-15

Best Hits

Swiss-Prot: 38% identical to DML_EUBBA: 2,3-dimethylmalate lyase (Dml) from Eubacterium barkeri

KEGG orthology group: None (inferred from 46% identity to tep:TepRe1_0405)

MetaCyc: 38% identical to 2,3-dimethylmalate lyase subunit (Eubacterium barkeri)
2,3-dimethylmalate lyase. [EC: 4.1.3.32]

Predicted SEED Role

No annotation

MetaCyc Pathways

• nicotinate degradation III (4/9 steps found)
• superpathway of nicotinate degradation (6/18 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.32

Protein Sequence (291 amino acids)

>GFF2758 2,3-dimethylmalate lyase (Xanthobacter sp. DMC5)
LPHPAELLRARLARSEILVVPGGGSPLELKLIEGAGFEAGYVSGYAAAAARHGVPDIGLV
AYAEQAELVRATRQVTDIPLIVDCDTGYGDVANVARTVRGMEALGVAAVQIEDQAWPKKC
GHMDGKIVEPEDVSLRKLDAAIAARRTDTVVIARTDARGPHGLEAALTRCRKFREAGADV
LFVDGPESAEELRIIGRELDGPLMVNMSESGKTPLFSAAELEAMGFSIVIFPSSTVRITV
RQIAAFLADLKASGDSRPWMDRMASLSETNAALGLPEIKAFEATILEGRKS