Protein Info for GFF2758 in Variovorax sp. SCN45

Annotation: Transcriptional regulator, RpiR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 278 to 295 (18 residues), see Phobius details PF01380: SIS" amino acids 165 to 285 (121 residues), 40.5 bits, see alignment E=2.4e-14

Best Hits

KEGG orthology group: None (inferred from 68% identity to bug:BC1001_2090)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>GFF2758 Transcriptional regulator, RpiR family (Variovorax sp. SCN45)
VPNPPEIEADGASPPRTVEALRALTMRLGRGDALISMGSKAHSVLARLVERPEEVAVRTI
TELAESLGVNASTLTRLATRLGYAGFVEFQTVFRDGLASRHRHFYSEQAGRLVAHASERS
TPQDGTGQRPEIDTMVQIAKDSIANTEGFLAQLSADELQQAARLLATAPRVRVHGLRQFS
ALASFLAYGLAMVRGDVALLDPHGLGVAEGLAQLQPGDLVVVTSVEPYTRSIAETAAAAA
KAGMVVVAITDHRASPLAAFAKHSFFVPHGSAFFSNSMGAYVIFCEGLLNLVATDLGKKA
LKALERRERFIADLGIE