Protein Info for GFF2748 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 50 to 73 (24 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 118 to 141 (24 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details TIGR00427: membrane protein, MarC family" amino acids 8 to 206 (199 residues), 276.3 bits, see alignment E=7.6e-87 PF01914: MarC" amino acids 9 to 210 (202 residues), 252.4 bits, see alignment E=1.3e-79

Best Hits

Swiss-Prot: 94% identical to YCHE_ECOLI: UPF0056 membrane protein YhcE (ychE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to ses:SARI_01205)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>GFF2748 Putative membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VIQPLFDFPVYFKFFIGLFALVNPVGIIPVFISMTSYQTATARNKTNLTANLSVAIILWS
SLFLGDGILQLFGISIDSFRIAGGILVVTIAMSMISGKLGEDKQNKQEKSETAIRESIGV
VPLALPLMAGPGAISSTIVWGTRYHSIAHLLGFSVAIALFALCCWGVFRMAPWLVRLLGQ
TGINVITRIMGLLLMALGIEFIVTGIKGIFPGLLN