Protein Info for GFF2741 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 159 to 179 (21 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details PF00520: Ion_trans" amino acids 26 to 246 (221 residues), 109.6 bits, see alignment E=2.2e-35 PF08016: PKD_channel" amino acids 128 to 223 (96 residues), 26 bits, see alignment E=8.7e-10 PF07885: Ion_trans_2" amino acids 165 to 239 (75 residues), 61.6 bits, see alignment E=7.9e-21

Best Hits

KEGG orthology group: None (inferred from 99% identity to sew:SeSA_A1875)

Predicted SEED Role

"Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>GFF2741 Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VSLSLSSVRRRLYHNLFDLTTRSGRRFEGLCALFALLSVLVIFVESGVGTEYHLTFDEWH
IFVWLELCVTLIFTGEYLLRLFSWPEPAKYVFSFWGFIDLVTILPLYVMWLWPEISLNYM
FAWRAMRAIRVLRILKLLRFMPSLRVFWSAIISARHQLILFYSFIAIVMIIFGALMYLIE
GPKYGFTTLNASVYWAIVTVTTVGYGDITPHTPLGRIVASVLILIGYSVIAIPTGLITTH
MSSAFQKRHWQRKCPQCQQSQHEHSAQYCNRCGSKLPD