Protein Info for PS417_13960 in Pseudomonas simiae WCS417

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 50 to 69 (20 residues), see Phobius details amino acids 76 to 95 (20 residues), see Phobius details amino acids 101 to 123 (23 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details amino acids 202 to 228 (27 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 315 (289 residues), 47.8 bits, see alignment E=5.1e-17

Best Hits

KEGG orthology group: None (inferred from 86% identity to pfs:PFLU3006)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UC69 at UniProt or InterPro

Protein Sequence (383 amino acids)

>PS417_13960 MFS transporter (Pseudomonas simiae WCS417)
MHNSSPTPWQRLAAIVLFAAITPTILMTAPAVAAQLAAQWQLSPAQIGDLFSVELGAMSL
ATLPAFWWLRCVNWRVAALAAAVLFIAANLMSTLADTYTQLLVLRLVSALAGGSLMIICL
ASAATTANPSRVYGLWVVGQLVVGAVGLAVLPGLFERYGLQSCYLILAGLMALLLPLARG
FPCAHAAPQAIGTAAAGTRRKALLGVGAVLAFYISLGGVWTFIGALGATAGISPQHSGEI
LAIATVMGIAGAACTSLIGSRLPRQQLLLAGYALMAAAVLLLLGQPTLVRFALAALLFKF
AWTFILPLILACLADLDHSGKLMNASNLMIGGGLAIGPAIAGRLIEASGGFAVLLMGGAV
ITLLSLAMILASRPGPVVEMEPV