Protein Info for GFF2736 in Xanthobacter sp. DMC5

Annotation: Antibiotic efflux pump outer membrane protein ArpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 21 to 488 (468 residues), 425.4 bits, see alignment E=1.4e-131 PF02321: OEP" amino acids 93 to 278 (186 residues), 111.4 bits, see alignment E=2.3e-36 amino acids 304 to 487 (184 residues), 107.9 bits, see alignment E=2.6e-35

Best Hits

KEGG orthology group: K03287, outer membrane factor, OMF family (inferred from 97% identity to xau:Xaut_1058)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein, NodT family" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>GFF2736 Antibiotic efflux pump outer membrane protein ArpC (Xanthobacter sp. DMC5)
MRDLSALSRLAPRLKGGVVAASLLLMNGCMVGPDFEAPDAPRVSGYLPEGTPRPTTSADV
HGGRSQAFLRGRDLPGEWWRVFRNKQIDAFVAEAIRNHPDIAAAQAALRAARENALAGEG
SLFPQVSANGSATRQVTSLASQGESGNTNPYNLYNASVSVSYVLDVWGGTRRNVEALEAQ
ADYQRFQLEATYLSLTANVVTAAITDASLRAQIEATNDIIKSEQEQLKLVQRQFELGAVA
QSDVLSQQSNLAQTQATLPPLQKQLAQQRNQLMAYLGRLPSQDRGEHVTLASLTLPRDLP
VSVPSALVRQRPDIGAAEASLHKATATVGVNVANMLPQVQLTGSYGRAGLTPDSLFSPGT
AAWSIAGSVAQTVFDGGTLYHDKESAVASNEQALAQYKSTVITAFRDVADSLRAIEADAS
TLKAQLAYEKAAQESVKISRTQYLAGAVTYPSVLTAEQNFQQAVVARVKAQAARFTDTAA
LFQALGGGWWNRVDQTAQAEPRTNAGYFQDH