Protein Info for GFF2732 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1100 1200 1264 TIGR00229: PAS domain S-box protein" amino acids 68 to 188 (121 residues), 31.6 bits, see alignment E=7.5e-12 amino acids 196 to 317 (122 residues), 24.5 bits, see alignment E=1.2e-09 amino acids 351 to 469 (119 residues), 55.1 bits, see alignment E=4.2e-19 amino acids 474 to 591 (118 residues), 32.7 bits, see alignment E=3.7e-12 amino acids 610 to 727 (118 residues), 64 bits, see alignment E=7.3e-22 amino acids 729 to 851 (123 residues), 49.8 bits, see alignment E=1.8e-17 amino acids 872 to 996 (125 residues), 57.3 bits, see alignment E=8.8e-20 PF00989: PAS" amino acids 75 to 181 (107 residues), 28.7 bits, see alignment E=4.7e-10 amino acids 198 to 307 (110 residues), 22.7 bits, see alignment E=3.5e-08 amino acids 350 to 449 (100 residues), 32 bits, see alignment E=4.4e-11 amino acids 610 to 707 (98 residues), 36.1 bits, see alignment 2.4e-12 amino acids 876 to 984 (109 residues), 34.6 bits, see alignment E=6.7e-12 PF08448: PAS_4" amino acids 80 to 183 (104 residues), 33.8 bits, see alignment E=1.4e-11 amino acids 204 to 312 (109 residues), 50.1 bits, see alignment E=1.2e-16 amino acids 354 to 463 (110 residues), 41.5 bits, see alignment E=5.5e-14 amino acids 481 to 587 (107 residues), 42.9 bits, see alignment E=2.1e-14 amino acids 612 to 721 (110 residues), 39.5 bits, see alignment E=2.4e-13 amino acids 739 to 847 (109 residues), 58 bits, see alignment E=4.1e-19 amino acids 882 to 995 (114 residues), 36.3 bits, see alignment E=2.3e-12 PF08447: PAS_3" amino acids 93 to 177 (85 residues), 48.7 bits, see alignment 3e-16 amino acids 370 to 452 (83 residues), 27 bits, see alignment 1.8e-09 amino acids 628 to 710 (83 residues), 35 bits, see alignment 5.9e-12 PF13426: PAS_9" amino acids 98 to 182 (85 residues), 18.4 bits, see alignment 8.4e-07 amino acids 357 to 461 (105 residues), 39.1 bits, see alignment E=3.2e-13 amino acids 616 to 718 (103 residues), 39.8 bits, see alignment E=1.9e-13 amino acids 756 to 844 (89 residues), 27.9 bits, see alignment 9.5e-10 amino acids 888 to 992 (105 residues), 46.8 bits, see alignment E=1.2e-15 PF13596: PAS_10" amino acids 740 to 843 (104 residues), 27 bits, see alignment E=2.5e-09 PF00512: HisKA" amino acids 1026 to 1090 (65 residues), 45.8 bits, see alignment 2.1e-15 PF02518: HATPase_c" amino acids 1134 to 1246 (113 residues), 80.8 bits, see alignment E=4e-26

Best Hits

Predicted SEED Role

"Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-)" in subsystem Oxidative stress or Oxygen and light sensor PpaA-PpsR (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (1264 amino acids)

>GFF2732 Phytochrome, two-component sensor histidine kinase (EC 2.7.3.-) (Hydrogenophaga sp. GW460-11-11-14-LB1)
VERERALLLELETLRAENEHLRRSYAQRLSGQPGSPDLKRQPNLPLALETALGPASANTA
DHTAQIEYEALFSALASVFPIGVFRTDHAGVLTHVDEKLQAIFALQKQDFPNFGWLSRVH
PDDLERVQQHWFRAISEAETLSVEFRLVRPGDEIVHVLVRNAPLRDANGAVVSQLGFMQD
ITPMRALEADARIKDELNRQIIASSPDCTKVLDLQGRVVQMTAQGCRLVEVDDFEQVRNS
DWTTWWPDDGALLSREALESARQGKSARFVAFGNTFKGTPKWWDTVVTPICDAQNRPVML
LAVSRDITALHRQQEEIQHFNAELEDRVRQRTDELAEAKERIHQALRDAQALYNQAPCGY
HSVDAEGVFVLINQTALDWLGYEHHEIVGKLRFHDIVAPEHQHLVSERLARMTRGEKLEP
AEFPIRRRNGSTFLALLSSTAVVDEEGRFVRTNNTLVDITERKAAENALAGQRNFLQAIT
NSVPVQLAFYDRDMICRFANASYARWVQGDTRQLVGMHLSQIARPQDFEASRLHLAAALS
GEIQRFEGERAFPDGHSFYAGIEYTPYWQAGQVQGIIIQMIDLSQRKASEDQVRQANGQL
NSALRQSQDLYNNAPCGYHSLDVNGIYVSINDTELDWLGYRREEVVGKMAFRDMMAPRHS
DLLERRMQKILKDDALEAVEYEMRRRDGSTFHALLSSSAVRDANGQFLRSNTTVVDITRR
KAAEMALRDNQRFLQTITDHVPGLMAYLDAGLHFRFANAEHLRVYGMDPQYIIGRHIGEC
VAPEIWADIEPRMRTALAGQPHHFETWRPTIDGQQIYVSASYLPDFNDEGTVQGLFVQII
DITDRKRIEERVIHLNEELEQRISERSLELLESEQRFRLMVDNLRDYCIFFMDAEGIITD
WTDSAQRMDGYSPTQMLGRHYGVLFDPANPDHGKVSAMQMLRLAASRGQHELHNWHTRKD
GSQYWSHSVLIALRDDSGELKGFAKINRDMTDAKRLDDLMRNINDELENRVVERTEQLLA
ANKDLESFSYSVSHDLRSPLRHISSFVSLLEEHLGGNCDEVSARYLSTIGNSARHMSQLI
DGLLAFSRLGRSAVNLTAVDFTLLVDAVVNQIGHDTEGRVVDWVVAPDLPVVQGDALLLR
EVWANLLGNAYKYTRPRERTRIEVGWSMDPVVGYTFFVRDNGVGFDTKYAQKLFGVFQRL
HRASEFEGTGIGLALTRRIIERHGGTIWAESQLGEGSVFYFSLPFEGTHGIESPPDSMPA
ALEP