Protein Info for GFF2731 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Outer membrane protein W precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13505: OMP_b-brl
  • amino acids 7 to 212 (206 residues), 45.2 bits, E=1.2e-15
• PF03922: OmpW
  • amino acids 23 to 212 (190 residues), 248.3 bits, E=6e-78

Best Hits

Swiss-Prot: 100% identical to OMPW_SALTY: Outer membrane protein W (ompW) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07275, outer membrane protein (inferred from 98% identity to spt:SPA1145)

Predicted SEED Role

"Outer membrane protein W precursor"

Protein Sequence (212 amino acids)

>GFF2731 Outer membrane protein W precursor (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKKFTVAALALTTLLSGSAFAHEAGEFFMRAGPATVRPTEGAGGTLGHLNGFDVSNNTQL
GLTFTYMATDNIGVELLAATPFRHKVGTGATGDIATVHLLPPTLMAQWYFGDSSSKVRPY
VGVGVNYTTFFDNDFNDNGKNAGLSDLSFKDSWGAAGQVGVDYLINRDWLIGASVWYMDI
DTTANYKMGGVQHHDSVRLDPWVFMFSAGYRF