Protein Info for GFF2723 in Variovorax sp. SCN45

Annotation: Uncharacterized homolog of gamma-carboxymuconolactone decarboxylase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07883: Cupin_2
  • amino acids 66 to 128 (63 residues), 45.8 bits, E=6.1e-16
• PF02311: AraC_binding
  • amino acids 70 to 146 (77 residues), 23.9 bits, E=4.7e-09
• PF02627: CMD
  • amino acids 186 to 270 (85 residues), 78.8 bits, E=3.7e-26

Best Hits

KEGG orthology group: K01607, 4-carboxymuconolactone decarboxylase [EC: 4.1.1.44] (inferred from 61% identity to rfr:Rfer_2441)

Predicted SEED Role

"4-carboxymuconolactone decarboxylase (EC 4.1.1.44)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 4.1.1.44)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (8/9 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (21/35 steps found)
• superpathway of aerobic toluene degradation (12/30 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.44

Use Curated BLAST to search for 4.1.1.44

Protein Sequence (277 amino acids)

>GFF2723 Uncharacterized homolog of gamma-carboxymuconolactone decarboxylase subunit (Variovorax sp. SCN45)
MRPLALAALTTLMMADATGAAEPESMVSHAASRAVQSAPAQNFTGSARVDMLFTPGGPDR
AAGGSVSFAPGARTNWHTHPLGQTLIVTAGVGRVQRAGGPVEEIRPGDVVRIPANTRHWH
GAAPDSAMTHIAIQEAQDGKTVDWQEAVTDEAYGALPAGQAARTTLQTAQPPQPSRAQRL
MGDVAPKLAQLTDDVLFGDVWARSELSPRDRSLVTISALIALNRPDQLRSHMALGMQNGL
TETEIVETLTHLAFYTGWPNAVAAVGVAREVFKTKPR