Protein Info for GFF2721 in Variovorax sp. SCN45

Annotation: ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 146 to 170 (25 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 111 (98 residues), 101.3 bits, see alignment E=1.8e-33 PF00528: BPD_transp_1" amino acids 35 to 216 (182 residues), 80.6 bits, see alignment E=6.5e-27

Best Hits

Swiss-Prot: 35% identical to GLNP_ECOLI: Glutamine transport system permease protein GlnP (glnP) from Escherichia coli (strain K12)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 98% identity to vap:Vapar_3419)

MetaCyc: 35% identical to L-glutamine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"polar amino acid ABC transporter, inner membrane subunit"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (223 amino acids)

>GFF2721 ABC transporter, permease protein (cluster 3, basic aa/glutamine/opines) (Variovorax sp. SCN45)
MNYQFQFDAVFAAWPLLLKGTWITIQLSLIATVLGLVVAIFCAWGKTSGPGWLRFIINAY
IEVIRNTPFLVQLFFFFFALPAIGLRWSPQTAALVAMVVNLGAYATEIIRAGIESIPKGQ
IEAGRALNLKPWEIFRFVIIKPALKAIYPALTSQFILLMLSSAVVSVISADDLTSVAANL
QSQTFRSFEIYIVVAAIYLALALAFSAMFKLIYKRTLNYPDRR