Protein Info for PS417_13865 in Pseudomonas simiae WCS417

Annotation: bestrophin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 54 to 71 (18 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 228 to 245 (18 residues), see Phobius details PF01062: Bestrophin" amino acids 1 to 276 (276 residues), 299.1 bits, see alignment E=1.9e-93

Best Hits

KEGG orthology group: K08994, putative membrane protein (inferred from 95% identity to pfs:PFLU3026)

Predicted SEED Role

"probable membrane protein STY1534"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U3V3 at UniProt or InterPro

Protein Sequence (297 amino acids)

>PS417_13865 bestrophin (Pseudomonas simiae WCS417)
MIVRPKPNLLGILFSLKGSIAKRIALRSLLVTLLASVIVLVETLHPAYFSKVNATPFTLL
GLSLSIFMSFRNNACYDRWWEGRKQLGQMIIDVRSLIRETQVLRDPAERAGLLRSVCGFA
HGLVARLRHEDEAQAIKPWSQFQANHPNLPDNLLQQVGARFSALAEQGVISEWRYTQLEA
RLVSLSQVQASCERIKSTPLPFPYTLLLHRTIYLFCILLPFAMAEPLGWLTPVFTAIVSY
TFFGLDEIGDDLEDPFGFDENDLPCNALLRTLEREVLAALGETDLPLPLEPVEYVLT