Protein Info for PS417_13860 in Pseudomonas simiae WCS417

Annotation: 3-hydroxy-2-methylbutyryl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00106: adh_short" amino acids 6 to 205 (200 residues), 147.8 bits, see alignment E=4.4e-47 PF08659: KR" amino acids 8 to 171 (164 residues), 40 bits, see alignment E=6.2e-14 PF13561: adh_short_C2" amino acids 14 to 248 (235 residues), 127.8 bits, see alignment E=7.7e-41

Best Hits

Swiss-Prot: 54% identical to HCD2_BOVIN: 3-hydroxyacyl-CoA dehydrogenase type-2 (HSD17B10) from Bos taurus

KEGG orthology group: None (inferred from 95% identity to pfs:PFLU3027)

MetaCyc: 84% identical to 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (Pseudomonas putida)
3-hydroxy-2-methylbutyryl-CoA dehydrogenase. [EC: 1.1.1.178]

Predicted SEED Role

"Probable acyl-CoA dehydrogenase (EC 1.3.99.3)" in subsystem Isoleucine degradation or Valine degradation (EC 1.3.99.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.3

Use Curated BLAST to search for 1.1.1.178 or 1.3.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UC49 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PS417_13860 3-hydroxy-2-methylbutyryl-CoA dehydrogenase (Pseudomonas simiae WCS417)
MQIENKIFLVSGGASGLGAATAEMLVAAGAKVMLVDLNADAVAAKAQQLGGNARSAVADI
SQEAAAEAAVQATVAAFGGLHGLVNCAGVVRGEKILGKDGPHGLASFAQVINVNLIGSFN
LLRLAAAAIAETEANADGERGVIINTASVAAFDGQIGQAAYAASKGAIASLTLPAARELA
RFGIRVMTIAPGIFETPMMAGMTEQVRESLAAGVPFPPRLGKPAEYAALVRHIIENSMLN
GEVIRLDGALRMAAK