Protein Info for GFF2713 in Xanthobacter sp. DMC5

Annotation: Tol-Pal system protein TolQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 transmembrane" amino acids 14 to 38 (25 residues), see Phobius details amino acids 59 to 85 (27 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details TIGR02805: tonB-system energizer ExbB" amino acids 6 to 139 (134 residues), 143.3 bits, see alignment E=2.7e-46 PF01618: MotA_ExbB" amino acids 54 to 139 (86 residues), 95.4 bits, see alignment E=1.1e-31

Best Hits

Swiss-Prot: 53% identical to EXBL2_HELPJ: Putative biopolymer transport protein ExbB-like 2 (jhp_1338) from Helicobacter pylori (strain J99 / ATCC 700824)

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 87% identity to xau:Xaut_2280)

Predicted SEED Role

"Ferric siderophore transport system, biopolymer transport protein ExbB" in subsystem Campylobacter Iron Metabolism or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (161 amino acids)

>GFF2713 Tol-Pal system protein TolQ (Xanthobacter sp. DMC5)
MDQMTWLKDAIDYGVIGLLLLLSILVVAVVLERIAFFVRVRPEAYTSSKVLELDLSKRLV
VVASVASNAPYIGLLGTVLGIMLTFSSMDLSAGADPGKIMVGLALALKATAAGLVVALVA
VVAYNALLRRAKVLMLKWEIAREGAKAATASAPLPAGASHG