Protein Info for GFF2710 in Xanthobacter sp. DMC5

Annotation: Iron(3+)-hydroxamate import ATP-binding protein FhuC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF00005: ABC_tran" amino acids 24 to 172 (149 residues), 106.4 bits, see alignment E=1.9e-34

Best Hits

Swiss-Prot: 65% identical to FHUC_ECOLI: Iron(3+)-hydroxamate import ATP-binding protein FhuC (fhuC) from Escherichia coli (strain K12)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 72% identity to oan:Oant_3476)

MetaCyc: 65% identical to iron(III) hydroxamate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-11-RXN [EC: 7.2.2.16]; TRANS-RXN-297 [EC: 7.2.2.16]; TRANS-RXN-298 [EC: 7.2.2.16]

Predicted SEED Role

"Ferric hydroxamate ABC transporter (TC 3.A.1.14.3), ATP-binding protein FhuC" in subsystem Iron acquisition in Vibrio or Siderophore Aerobactin (TC 3.A.1.14.3)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34 or 7.2.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>GFF2710 Iron(3+)-hydroxamate import ATP-binding protein FhuC (Xanthobacter sp. DMC5)
MTTDTTDLFTLQDVTYAVAGRVLLEPLTLDIPARRVVGLIGHNGSGKSTLLKLLARQQSP
SGGALRFAGKALTEWGHRPFARKVAYLPQQTPPAQGLLVRELVALGRYPWHGALGRFGAA
DREKVVEAIALTGMEAFADRLVDTLSGGERQRAFIAMLVAQDAECLLLDEPISALDIAHQ
MELLSLVHRLAAERGLAMVVVLHDVNMAARFCDEIVALRAGKLIARGTPNHIMTADTLEM
IYGIAMDVLTRPPGAAPLAFAH