Protein Info for PS417_01380 in Pseudomonas simiae WCS417

Annotation: nucleotide cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 350 to 370 (21 residues), see Phobius details amino acids 391 to 412 (22 residues), see Phobius details amino acids 419 to 438 (20 residues), see Phobius details PF05226: CHASE2" amino acids 26 to 366 (341 residues), 82.3 bits, see alignment E=2.3e-27

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0W3 at UniProt or InterPro

Protein Sequence (446 amino acids)

>PS417_01380 nucleotide cyclase (Pseudomonas simiae WCS417)
MSTPPLFNHRRYWLAAIIVLLAVLDPFGLASSSDKASAQWLNRMFASHYSNEGQQRVAVV
VIDDAYLMRNGTSWPMPYGEQSKLFKRLLAYKPKAVFVDLLYSHDHSFGDPARGSQLLAN
VFERYQRQGIPLWLANTGVVRGEAGQANTLQPFAEVSRPGLVAWEGVDDQYPLAVQTPLG
LMETPAMVLYRELCRTQKCQSPPVDAQTAAQRQPIAVQWGLKLAPEQARIADVRHCAPAR
HFVLDGLAQFFQAVFWKLDDSAQARCPYTLTVSASDLEVSDPQDQALLTELLRDRLVLVG
ANITSTGDLVDSPVHGQLPGVYLHAMALDNLINAGMDYAHEPANFPGLPFNWLDLLELAL
LALIAVLKALHARRLAGHRPWSRWRRREIRFFSSPCPSWLLVMSVLALMSVLLSVNNITP
VNVLGIVLLSLVLFSERIEAFFDRDR